General Information

  • ID:  hor006207
  • Uniprot ID:  P37044
  • Protein name:  Progonadoliberin-2
  • Gene name:  gnrh2
  • Organism:  Haplochromis burtoni (Burton's mouthbrooder) (Chromis burtoni)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  Expressed in only one cell group in the mesencephalon.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Haplochromis (genus), Haplochromini (tribe), Pseudocrenilabrinae (subfamily), African cichlids, Cichlidae (family), Cichliformes (order), Cichlomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSHGWYPGGKRELDSFGTSEISEEIKLCEAGECSYLRPQRRSILRNILLDALARELQKRK
  • Length:  62(24-85)
  • Propeptide:  MCVSRLALLLGLLLCVGAQLSFAQHWSHGWYPGGKRELDSFGTSEISEEIKLCEAGECSYLRPQRRSILRNILLDALARELQKRK
  • Signal peptide:  MCVSRLALLLGLLLCVGAQLSFA
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P37044-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006207_AF2.pdbhor006207_ESM.pdb

Physical Information

Mass: 834546 Formula: C318H507N97O94S2
Absent amino acids: MV Common amino acids: LER
pI: 8.76 Basic residues: 13
Polar residues: 17 Hydrophobic residues: 18
Hydrophobicity: -84.68 Boman Index: -16821
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 80.32
Instability Index: 9467.26 Extinction Coefficient cystines: 14105
Absorbance 280nm: 231.23

Literature

  • PubMed ID:  8108425
  • Title:  A second gene for gonadotropin-releasing hormone: cDNA and expression pattern in the brain.
  • PubMed ID:  9748399
  • Title:  Genomic structure and expression sites of three gonadotropin-releasing hormone genes in one species.